Repurposing a peptide toxin from wasp venom into antiinfectives with dual antimicrobial and immunomodulatory properties
نویسندگان
چکیده
منابع مشابه
Paulistine--The Functional Duality of a Wasp Venom Peptide Toxin.
It has been reported that Paulistine in the venom of the wasp Polybia paulista co-exists as two different forms: an oxidized form presenting a compact structure due to the presence of a disulfide bridge, which causes inflammation through an apparent interaction with receptors in the 5-lipoxygenase pathway, and a naturally reduced form (without the disulfide bridge) that exists in a linear confo...
متن کاملA novel bioactive peptide from wasp venom
Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...
متن کاملLL37, a human antimicrobial peptide with immunomodulatory properties
Cationic antimicrobial peptides (AMPs) represent the first line of defense against many invading pathogens. These small amphipathic peptides are part of the innate immune system and have a broad-spectrum activity against bacteria, fungi and viruses. In mammals, at least two distinct groups of AMPs are found. Defensins are the more representatives and cathelicidins form the second group. The hCA...
متن کاملPharmacological and Immunological Properties of Wasp Venom
Animal toxin envenomations have medical as well as ecological significance. Toxin-producing animals are categorized under either venomous group or poisonous group. Venomous animals are capable of producing and delivering the toxin during a biting or stinging act whereas poisonous animals are those whose tissues, either in whole or in part, are toxic. [1] About 75% of the world’s animal species ...
متن کاملAn anti-infective synthetic peptide with dual antimicrobial and immunomodulatory activities
Antibiotic-resistant infections are predicted to kill 10 million people per year by 2050, costing the global economy $100 trillion. Therefore, there is an urgent need to develop alternative technologies. We have engineered a synthetic peptide called clavanin-MO, derived from a marine tunicate antimicrobial peptide, which exhibits potent antimicrobial and immunomodulatory properties both in vitr...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Proceedings of the National Academy of Sciences
سال: 2020
ISSN: 0027-8424,1091-6490
DOI: 10.1073/pnas.2012379117